DPCstruct | MC449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 55 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A270R033 | 2-52 | PSPDGCRWCGDDPGHHGSQWVASAGLHTWEAPTPQQRLMRMKARRAARQAG |
| A0A1H8SX84 | 39-85 | PPTPFGCRWCGTPQHHHGRQYLRGRGMHGWEQPTNAQILARMQARRN |
| A0A327U063 | 6-57 | None |
| A0A327U0Q4 | 3-54 | None |
| A0A7H8LRP1 | 1-50 | None |
| A0A559VBF5 | 2-50 | None |
| A0A2N3ZEN4 | 22-78 | None |
| A0A1Y5LEN8 | 37-87 | None |
| A0A1Q4W4G7 | 116-165 | None |
| A0A6G3W8J2 | 17-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.