DPCstruct | MC44894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836MAY9 | 1-98 | MTDIATNQAEKTALINMNTHREAQLKYWAGYSLTEIAKMLNIPVSTIASWKKREKWDEAPLFERVSGNIENRYMLLLQKDVKTGYDF… |
| G5LKD7 | 1-75 | MLLYFQGYRVARIAEMLGEKVATVHSWKKRDKWGDYGPLDQMQLTTAARYCQLIMKEHKEGKDFKEIDLLARAPV |
| A0A8B5PAP2 | 19-89 | None |
| A0A6N8MUV5 | 3-82 | None |
| A0A2H1QIN2 | 1-80 | None |
| A0A377CZB1 | 7-84 | None |
| D4DNQ4 | 101-179 | None |
| A0A376KK44 | 7-84 | None |
| Q8XY24 | 15-97 | None |
| A0A250B6V4 | 7-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.