DPCstruct | MC44886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 286 ± 37 aa |
| Standard deviation of domain lengths | 36.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4KV88 | 2-298 | SDAADPQPPAATLPGENRESNDVRYSKLLKQKRGEFLDHLLRSLDMIAYCHFSYLYFLDCSLFRFIIRSAIQLNFLTPKPPNFPVHS… |
| A0A317XIC9 | 2-222 | YFERRELIQSLDLLSYLLFVYIWLLDGRTLWLAIRAILQVQICNLIYINPTWSLSFSAIFLCSINALFAIVCIFGPPIGSLKQSSIL… |
| A0A0C9VN84 | 3-253 | None |
| A0A0D2IAM0 | 229-527 | None |
| A0A0A2V782 | 1-340 | None |
| A0A0M9VRT2 | 61-351 | None |
| A0A177UXM3 | 2-285 | None |
| A0A1E3PPV3 | 1-336 | None |
| A0A3M6YLD9 | 1-335 | None |
| A0A5C3EYP2 | 2-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.