DPCstruct | MC4488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 257 ± 32 aa |
| Standard deviation of domain lengths | 32.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 51.67 |
| Assigned Pfam label(s) | CL0220- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5WT07 | 22-289 | KLEETEIAEEGHCDGDEPCFFDDIDDEEDASVPVTLRKDGDEKQNGEYPVFDHLSRLDGVKVGDVLKKVVNGKTYELHTRSLKPLLF… |
| A0A2G8KB15 | 1-236 | MFLSSVSVIRATSCKALDSDDGLRDWYTNHETNVCRVGNRMVLPQLNPVKIGKVRQLELEPGRVFEVKTVATKPPIFLIPNFLTNEE… |
| A7RK78 | 52-312 | None |
| A0A3M6UWI9 | 549-818 | None |
| A0A3Q2D2K0 | 30-332 | None |
| A0A7M7SZ82 | 46-289 | None |
| A0A3M6V113 | 380-669 | None |
| A7SQC5 | 2-255 | None |
| A0A2I0M9U7 | 1-191 | None |
| R1BCV3 | 13-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.