DPCstruct | MC44879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 236 ± 69 aa |
| Standard deviation of domain lengths | 68.71 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14857 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177WEM4 | 40-254 | DKNPDELWRFFMSNLQNPRLMVDIHGYHTETKYIEEVRDGESRTTSRQEDVSDFRIKIDVTRLMSTYWSRIVCVPDKNASPRNLRET… |
| A0A7S3LE17 | 192-362 | AFFDKLYRTKPTLSLSMECYHYRTVTYEDSKGRKRTKREKVTTWRGTEHVTIVAWEDVTSHRLDQPRLSEYQLTKVRISKVFTADKN… |
| A0A507FLY6 | 353-627 | None |
| A2F9D3 | 60-267 | None |
| A0A1S3J4L5 | 138-335 | None |
| A0A7S3LQJ4 | 74-243 | None |
| A0A0B7NDU5 | 101-392 | None |
| A0A7S2V6S2 | 1-172 | None |
| A0A813VIQ2 | 59-338 | None |
| A0A7S2ADX6 | 544-728 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.