DPCstruct | MC44878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 260 ± 32 aa |
| Standard deviation of domain lengths | 32.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 39.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8CNJ4 | 27-228 | SELAIYHLYTFFNLKKGIPIKLNAFTELLIIGFLRDRLVLLSKKLYFVAVCSVSSLEERASKRSYAGCLFQLNILISPFLLCLAIIS… |
| A0A177WAE4 | 1-297 | MPYMSNSNVQILAANFGSLDWIWAALMMSRCFVLAWHRAEETAFDIAVIETINAIISANSSTGTCNGENMSGFGAWWCALELGTRLL… |
| A0A7J5Y7F4 | 8-243 | None |
| D2VSJ2 | 2-243 | None |
| A0A3P6RRK5 | 41-324 | None |
| A0A3P7E3H9 | 2-261 | None |
| A0A368FWK9 | 743-987 | None |
| A0A7S1NMX3 | 55-324 | None |
| A0A3P7I992 | 1-224 | None |
| A0A1Y1JUQ8 | 570-815 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.