DPCstruct | MC44875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 199 ± 44 aa |
| Standard deviation of domain lengths | 43.90 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9P4X1 | 39-207 | PVSVKFLLNWFHPYGLMGLADKYNLPFKVACRIGGIGYKGLSTLGWRAQRLFLMYERRRLLFDLWLGGGQPLNPYHYGILVESLRSE… |
| M1FPH7 | 3-143 | SLCHLYKIQRFSTLCRLYGIGYRLLCKLNHTKSSTVLRLKAIWLKAKLPFELWLGQCCPVDPYLKGRLIWKLQQAFRPKDLVVPPTS… |
| A0A5N6L0Z4 | 39-301 | None |
| A0A3S3NZZ5 | 2-235 | None |
| A0A6P5MYK9 | 93-296 | None |
| A0A6V7PYJ7 | 13-195 | None |
| U5D0V6 | 2-209 | None |
| A0A4S4ESN3 | 6-277 | None |
| A0A2J6KD10 | 2-169 | None |
| A0A5N6LCG9 | 48-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.