DPCstruct | MC44872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395HPL5 | 221-303 | YMGMFRHWLTVALDICDFSLPSETITTVYGDILLDRKFSGKVFLQGVLLPETKLGRGKFTYGYNLQHATVSGNRRSFSSPQEE |
| G2YV83 | 1-105 | MGRGRGNKAASITKAEVMEWLKVCIHFDRPKEIVRTSCGNLILDSNFRGKVYLKGLFLEKTSRTRVIKYGYDFAQGHIGRDRKGMED… |
| A0A370PHC4 | 257-356 | None |
| A0A0U5GP37 | 4-98 | None |
| A0A6M7YU40 | 451-551 | None |
| L2FWQ8 | 162-259 | None |
| A0A319DKD5 | 3-90 | None |
| Q2TX54 | 2-76 | None |
| A0A7S4M0X7 | 1-99 | None |
| A0A6A5UDA5 | 216-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.