DPCstruct | MC4487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 236 ± 16 aa |
| Standard deviation of domain lengths | 16.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3JIM5 | 328-559 | ENERVSSFCPDLRDRLTQAQDRSIAKVLSPSVSTFIHSVPFQPATDNRSNFGSDKAFHTFKKQRDIFYELLREWEDFHKEPGWNFDT… |
| A0A2G8K9L6 | 1-245 | MLAGVPFHVETDNRENFPSDRSFHCFKKQRDKFYELLREWQVQHTIPGWSMHASMATRIRELVAMATDITNIFHFAKLFTSQLIKMC… |
| T1KJJ0 | 1-213 | None |
| V4AE51 | 486-711 | None |
| A0A5E4BME6 | 55-302 | None |
| S7NY37 | 4-225 | None |
| A0A7T8H2E2 | 1-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.