DPCstruct | MC44869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2YIS9 | 1-118 | MGSQWHTIKPYTAAVAPVWVALSPDDVLDNMDGAASKWGSATDASGKERVIRTEVPGWGWEGKTPKTIDTGERRKGRQRNAEPLTRE… |
| A0A1S8BG86 | 188-308 | MLAAYISRWLGSPWHPTRPYPAAVAPVWLALASQELLDDAEELEGKGKWGSSTDRAGNERVSRTEVEGWGWGGIVGEATNRKGRRRG… |
| M2NF21 | 789-912 | None |
| A0A366Q1B3 | 151-281 | None |
| A0A0F8WRL9 | 1-149 | None |
| U7PZA6 | 350-497 | None |
| A0A0D2XQE0 | 81-211 | None |
| T5ACF5 | 59-189 | None |
| W9XMX8 | 276-398 | None |
| A0A2J5HVM1 | 199-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.