DPCstruct | MC44863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 22 aa |
| Standard deviation of domain lengths | 21.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9K5K0 | 1-111 | MKVASQNEQKAEEMLSAFTYGLNNPLIDISNLDMATGEGATYTATGQPVTDASEALFASQNESLIKRNEILIAQEREKGTPAAKILE… |
| A0A3M2VSM1 | 1-130 | MLQKSIHEKEAPHYGKTILRGGELRHTLMAQAENNPSEASFLAKQYTHNSLNGEGVDLSDYPVIRYCATGEIVTPESSAYFQKTERW… |
| A0A0D6G4H4 | 32-191 | None |
| A0A1H4GPR4 | 4-172 | None |
| A0A059KJL1 | 2-101 | None |
| A0A424WGI2 | 63-187 | None |
| A0A1Y6JS02 | 94-244 | None |
| A0A2E9DER2 | 5-155 | None |
| A0A2S9GTI2 | 24-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.