DPCstruct | MC44860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 73.73 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF00223- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3D3G0 | 1-135 | MDNGDGIVVAWLGHPIFRDKEGRGLFVRRMPTFFETYPVILVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGKLNGVSYSDPAI… |
| A0A6A4N2W3 | 188-338 | MDSGDGIAVGWLGHPIFKDKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVGYNDPAT… |
| A0A7J9KP56 | 113-206 | None |
| A0A830C908 | 93-260 | None |
| A0A814RG48 | 330-480 | None |
| A0A2R4QHC3 | 292-426 | None |
| A0A1S4AEF0 | 41-192 | None |
| B9SD21 | 119-266 | None |
| A0A650F2R9 | 100-250 | None |
| A0A453N3H7 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.