DPCstruct | MC4486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821UL40 | 1-106 | HVSSSITKSRQFSTSPTNQILHSRKYRYGAWYLPKNLWQHSLKTEELQDPKILQAEREDPTRKREEQMNARLAPLHGIDAFKEYLVE… |
| A0A7E6DH30 | 130-225 | PSKPKYVKMRYGAWYLDPKLWKMQRADEPLVDPKVLRKAQDELLKKQQQEQEELLSFAKLYGPAAFKEFILRKGYRMPSFLEKINVR… |
| A0A670ZUP8 | 156-266 | None |
| A0A6J0XLD8 | 271-365 | None |
| E9Q0Z5 | 150-259 | None |
| A0A384CAH9 | 352-455 | None |
| A0A4W5QZI5 | 327-439 | None |
| A0A813V3E7 | 316-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.