DPCstruct | MC44858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.53 |
| Pfam Score | 79.09 |
| Assigned Pfam label(s) | CL0344- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I0KLZ0 | 4-115 | LAYGARAITEGGYQSVPRLSFAGGVLIGCAAGFVNVPRIKGVHNAMGSAMLAAEHVNAALAAGRANDELVDYENAWRSSPVGEDLFK… |
| A0A2G3CUE3 | 1-110 | MLAAESAFSMLQKGLKMENYWDNLRSSWIWEELYTARNYRPAFEYGLYPGLALSAVEHYILKGRSPVTLNHGKPDHEATRGEHDWHH… |
| A0A7F8QQW2 | 320-464 | None |
| A0A7J6S2S0 | 673-799 | None |
| A0A0V0J8P4 | 62-183 | None |
| A0A7W8H2J0 | 172-313 | None |
| A0A446JW70 | 2-108 | None |
| F4Q8G1 | 971-1114 | None |
| A0A855HMG5 | 1-137 | None |
| A0A2A2K9F3 | 20-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.