DPCstruct | MC44856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 96 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 58.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2XIB6 | 4-79 | QFQENLQRLIHDEIEKIKGFPRDTNAPFRERLKFLGRVVNTEDLQLSAAEKKLLSAYNEKPVLSRPQHEFYLGENY |
| A0A388LYS8 | 503-595 | KSAPEEAMAVLKKFMEDDVEQVPGILGANTVKYRDQLKVVARIANLDEVYLSNTEKKLVSNYNEKPVLSRPQHVFYQGKNYMEVDID… |
| A0A6A4PZY9 | 182-290 | None |
| A0A6A6LQA4 | 144-228 | None |
| A0A2U1MHR3 | 520-619 | None |
| A0A6P5XGD1 | 393-470 | None |
| A0A426ZIN0 | 77-143 | None |
| A0A5A7PGC7 | 256-388 | None |
| A0A0K9R3P8 | 18-104 | None |
| A0A1D6Q422 | 38-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.