DPCstruct | MC44854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00162 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3CF96 | 17-84 | DLELDYLVGAVSTKRPFTAIVGGSKVSSKIGVIESLLEKCDILLLGGGMILTFYKAQGLSVGSSLAEE |
| A0A7V0YGN4 | 31-99 | EKEVDTLTSILEKPERPFVAVLGGSKVSDKIGVIDKLLDVVDALLIGGGMAFTFLKAKGYEVGSSLLEE |
| W7ZFH1 | 1-65 | None |
| S4RBY2 | 54-116 | None |
| A0A6P4L8Y7 | 82-154 | None |
| A0A080ZPH0 | 834-902 | None |
| A0A6G1E3W9 | 176-245 | None |
| A0A287XR01 | 83-152 | None |
| A0A7U6Y4M2 | 178-247 | None |
| A0A812SGW4 | 51-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.