DPCstruct | MC44853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7DVW2 | 86-154 | TYFPASELPLDIKSRLETLFDVQEKWTYDEIRPFLDDLADSKNPVSTLLMKHARGFTVDGTKYYSERYS |
| A0A2G3CF79 | 1-90 | MNASFDVLEEVLTEKLGIETRIYAFSVSSLPSVPAEWFFKLFQEKPKWGWQVLQPFIRDLKVPGLSSEGLLLKYTRTQPSADAEPIF… |
| A0A2J6K4G0 | 80-188 | None |
| A0A3L6FR04 | 664-743 | None |
| A0A4Y9Y415 | 212-276 | None |
| H0ZQ56 | 492-556 | None |
| A0A7J0FPW7 | 506-614 | None |
| A0A7R9BMP9 | 1083-1149 | None |
| A0A6J1ZUK6 | 415-479 | None |
| A0A2G8SJQ6 | 568-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.