DPCstruct | MC44852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 159 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 45.98 |
| Assigned Pfam label(s) | CL0229- PF06001- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3CEZ1 | 284-422 | CGARIKSNRTYYTIGAGDTRQYCCFRCYYKASGDTIIVEGTTIPKARMDEKRNGEETEEWWVQCDKCKAWQHQICALFNGRRNDCGR… |
| A0A0S7KL21 | 71-217 | KLEFSPQTLCCYGKQLCTIPRDAVYFSYQNRYHYCEKCFNEIQGETVSLGDDPTQPQTSINKDQFEKKKNDTLDPELLVECMDCGRR… |
| G0P2K9 | 117-244 | None |
| A0A0L9UT52 | 5-157 | None |
| A0A287XFW3 | 233-362 | None |
| A0A7E4W0D6 | 338-491 | None |
| A0A7S1UT71 | 6-180 | None |
| A0A4U5MGA9 | 146-314 | None |
| A0A835HED8 | 21-198 | None |
| T1EGR3 | 151-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.