DPCstruct | MC44851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 164 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654IMC3 | 10-162 | NILIVVFNLFLIIPILWFSFHFIKNNKIQILEFDIKGIKGKLSEIDQKDETIFDKEIKEIIYLLYSSNVDYVVFDDLDRYKSIEVFE… |
| A0A069RE95 | 1-169 | MKLQEIFVNPQSIVQSFGDSWLVYIVGMIFVIMLVLVMYKMPNTILESLKVAKVKFPSTEIEITGDDKDSIYNKYLDELLYFFEETQ… |
| U6FEG8 | 4-190 | None |
| A0A414CP03 | 1-160 | None |
| A0A3E0VBX4 | 27-188 | None |
| A0A374V769 | 11-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.