DPCstruct | MC4485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 124 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4D652 | 59-177 | ARIGLAEEIRHMFHVAWVDPEDPYKGFKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESS… |
| A0A1I8BRK7 | 4-117 | ILFCARIGFASDIKNHLNIIWNDDDRPEDGFRYLTLDSKIENSEILSQIESTLLNNGNRRIDAIIGKEGDIGVENLVGSGLIAAETS… |
| A0A4P9Y308 | 152-284 | None |
| A0A1D2NFA1 | 418-536 | None |
| A0A7R9PVD6 | 119-236 | None |
| A0A821UC68 | 577-707 | None |
| B4DYJ7 | 329-447 | None |
| A0A7S3GGZ4 | 14-138 | None |
| A0A7S3LWC0 | 11-139 | None |
| A0A673HFZ2 | 463-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.