DPCstruct | MC44844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 538 |
|---|---|
| Mean domain length (aa) | 279 ± 74 aa |
| Standard deviation of domain lengths | 74.11 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 72.61 |
| Assigned Pfam label(s) | PF02770- CL0087- CL0304- CL0015- PF11794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A347PZW7 | 26-337 | CRVVQAAASWTMPVVFSLAINNGFGSHTYLPALPPGPLRDVIAERAVGGYRITGEKVVIGNGSVAELLDVSATVVAADGSESVRLFF… |
| A0A3S4GKJ4 | 1-222 | MDKVLIPWENVLIYRDFDRCRRWTMEGGFARMYPLQACVRLAVKLDFITGLLKKSLECTGTSEFRGVQADLGEVVAWRNMFWALSDS… |
| I1CD12 | 44-342 | None |
| A0A4V6YXV4 | 57-392 | None |
| A0A2E1CU27 | 37-399 | None |
| A0A1I6UT59 | 7-202 | None |
| A0A0V0QMV6 | 345-705 | None |
| A0A1I8IJK0 | 18-245 | None |
| C3ZV57 | 868-1227 | None |
| A0A136PJG3 | 62-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.