DPCstruct | MC44842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 582 ± 95 aa |
| Standard deviation of domain lengths | 94.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0DRC3 | 117-745 | KGKVRAVVTGTGLTLRAAPSPQSHGTLAGAAIRQINSLGQNEDLVLCTNSVIEFDSGKVFSLKIGSKLYKMAECSFVPSTSGATTGL… |
| A0A379U0H3 | 82-491 | PRFLSNSEHVERDKPAFGKYPAGIPLYMKNSVNAIYQSQLTTHQDGIFPLNGSQHTEDNQVTYWQAGASRGYLAESDLKLLSRYDLA… |
| A0A336N2C5 | 17-570 | None |
| A0A3D9V3P5 | 53-604 | None |
| A0A1E5QL45 | 185-730 | None |
| A0A659L0E6 | 99-688 | None |
| A0A2N6FQ06 | 10-734 | None |
| A0A1H1LQD9 | 188-906 | None |
| A0A423ES90 | 63-699 | None |
| A0A7R8RD58 | 75-795 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.