DPCstruct | MC44841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 589 |
|---|---|
| Mean domain length (aa) | 210 ± 34 aa |
| Standard deviation of domain lengths | 33.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 13.23 |
| Pfam Score | 42.39 |
| Assigned Pfam label(s) | CL0123- PF08708- PF16793- CL0243- PF08800 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662QZL8 | 156-341 | SISKFLSFLVRGNFYWETRFIREKVISDKFHSNIIEIFEHLSKFRLNEADFYIGINPRSEKIRKKEGVKFGNVIFVDFDSEMARNDI… |
| A0A354C5H6 | 8-232 | KTFTLFDSEVWKFFFNPGEVTEVRIPKVLNRGTVSGYFDDHEIFCKEVKKADKELNHDGIYFTLQVIDPRLLARAFNRLKVSSLTTS… |
| A0A7T5JUD8 | 100-328 | None |
| A0A847SNH6 | 153-403 | None |
| A0A4Y3K783 | 5-142 | None |
| A0A4R5MCJ8 | 26-225 | None |
| A0A6G6YMQ7 | 20-207 | None |
| A0A6G1LY60 | 97-281 | None |
| A0A146HC71 | 163-360 | None |
| A0A2A2YA74 | 109-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.