DPCstruct | MC44834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 195 ± 24 aa |
| Standard deviation of domain lengths | 23.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2BS84 | 1-177 | VPDILSENVCFDAAVKSTNLADRRTMVINTIGFTGCVYNSAANAVIFGKTDSISVAENLVLPNFEYLCDGIAAPVVLPTTTTGLDYS… |
| A0A812H048 | 493-663 | DLKTASACKRAAEYLGQTYIEEEEDADWPHGCYEIAAGRYQGVYFNKSPTGSAVRGTFPLCKILPLHAPATADGSCPATHVKSETGA… |
| A0A813B8E9 | 1-206 | None |
| A0A7S2JQD0 | 2-178 | None |
| A0A7S0E533 | 42-266 | None |
| A0A812UDQ3 | 87-321 | None |
| A0A812Y5G8 | 762-957 | None |
| A0A7S0CE20 | 114-286 | None |
| A0A812KS51 | 114-292 | None |
| K0R4M0 | 220-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.