DPCstruct | MC44823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7B497 | 1-77 | MLRLGLYGRANKCRALVSEDSLGQVASQNAGNFTVVNDAATLPFLRPPIGMDKVEMTEQAQKIGTHETLIELDQDCC |
| R6YHV4 | 79-140 | RVARDEGCAALVTGESLGQVASQTIQAIACTDAVASLPVFRPLIGTDKSEIVELARRIDTFD |
| W1HYP0 | 107-188 | None |
| A0A0H1SAM8 | 204-270 | None |
| A0A256YII7 | 14-90 | None |
| A0A1Q6Q9M8 | 269-341 | None |
| A0A2N1PWB7 | 9-86 | None |
| A0A7J2VZR4 | 23-99 | None |
| A0A7C5D4W8 | 5-79 | None |
| A0A497KH54 | 18-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.