DPCstruct | MC44820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379UPA7 | 1-115 | MATIGAILPGDFKIKAAKLRGEPSEGMLCSFSELGISDDHSGIIELPADAPLGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARD… |
| A0A2I7CB61 | 17-143 | VCGAPNCRLGLKVAVATVGAVLPGDFKIKAAKLRGEPSEGMLCSFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTP… |
| A5M6K2 | 1-128 | None |
| X8DSA6 | 40-174 | None |
| A1HPG0 | 78-206 | None |
| A0A6I1IUX3 | 3-90 | None |
| A0A379FFN5 | 1-127 | None |
| A0A354VHM5 | 9-130 | None |
| A0A378W1G6 | 1-117 | None |
| J9GS99 | 52-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.