DPCstruct | MC4482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 54 ± 2 aa |
| Standard deviation of domain lengths | 2.26 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 65.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3H302 | 1-50 | MMLQVDVDTVNGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI |
| A0A1I8B840 | 3-58 | EGSTLLQLNVNINGGGLCVNPEFRIDFEKSDDLPNGPYLAHEMRYPGGDCTSDIWI |
| A0A226NX16 | 197-250 | None |
| A0A8B6CMS7 | 54-108 | None |
| A0A210Q6P9 | 1-59 | None |
| A0A5N4AG49 | 89-142 | None |
| A0A844MNL5 | 171-222 | None |
| A0A402FXG6 | 185-237 | None |
| A0A151M592 | 385-438 | None |
| A0A402E6X0 | 71-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.