DPCstruct | MC44814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 273 ± 45 aa |
| Standard deviation of domain lengths | 45.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2KJF2 | 5-233 | PAPPHEWAVLTGRIDAVAWRTVVAATPDEQRRALAALLGVWSRQPFAETGSSWRIGRAPEQRIAALRADGFAVASGPERSGLAPFLQ… |
| A0A1Q9UGY4 | 13-279 | VAAVRYLADLLAEAAGSGPAYDTPHPLGRVDAPRPNYLQFGTLGGEALLAARPWTAEYQRAKARDVLGALGDTPWGDGSGRWRRLWF… |
| A0A1I5GSP1 | 915-1156 | None |
| A0A3P1T5R1 | 418-667 | None |
| A0A1T3NJ49 | 2-371 | None |
| A0A8A9ANX4 | 17-247 | None |
| A0A7W3MSK1 | 399-692 | None |
| A0A7W3LUN7 | 535-823 | None |
| A0A1K2FB78 | 602-833 | None |
| A0A562DAZ9 | 2-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.