DPCstruct | MC44812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 253 ± 49 aa |
| Standard deviation of domain lengths | 49.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3JYT9 | 49-310 | YSRFELRLRKHLSLAEESLWQKCAQKLIAAIPHIPEWRQPLIALLLPEKPEIAHEIAQRLLGQKKLPSLEWLKIVATDEHILGLIRK… |
| Q32EI9 | 122-358 | DELVDDLVIRCGLESAVEIALLALQLKYKPVKGAVTTIIPPNHEAESLPSWHQRLCHHLSLASEDEWQRCVDKVLAAIPTLSPARQP… |
| A0A4R4ZZP7 | 155-400 | None |
| A0A6G3I5M9 | 158-431 | None |
| A0A376SKE8 | 1-192 | None |
| A0A376VH65 | 67-319 | None |
| A0A345XSA4 | 155-403 | None |
| A0A376ZGH9 | 94-370 | None |
| S1EIR3 | 222-533 | None |
| A0A383G5I2 | 1-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.