DPCstruct | MC44807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 73 ± 2 aa |
| Standard deviation of domain lengths | 1.89 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1DH30 | 11-83 | DLLPFFYTQEALSHVAKCVDQVQEKLDRRLLMENLSSYLSFTHSEMSEGEFLSEVSQRTGCAILLDVNNLYVN |
| A0A0A2VYJ3 | 188-258 | DLLPVPRTTRLMHRLVDNITRTQDALGCQISLENPTHYLQMPEHEWEEIEFLDEVSRRSGCGLLLDLNNVW |
| M2U9E6 | 79-152 | None |
| A0A2S3XPF4 | 111-182 | None |
| J5L2G8 | 1-69 | None |
| A0A2S9RD05 | 24-96 | None |
| A0A5S3QUR8 | 1-72 | None |
| A0A6P3Z2F6 | 52-124 | None |
| A0A812ZWV4 | 242-313 | None |
| Q08YT1 | 11-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.