DPCstruct | MC44806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 120 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | CL0413- PF11795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A323TSZ1 | 34-155 | LIGERRRLLGELLDAVLPPAAIDASATGANGFAQRYGLRQRPTLIRFRVLDPSIAIAGLTDLSVPVDDFAALSIPPGPVFITENKIN… |
| A0A3S0AY02 | 171-274 | IGDHDKVVAAVHSMQGFRQKPLMVEMRTLDPTLLVGDFLHVLCPVTELAARQVAAENIIIVENHQSFLALPQLEGTWAMFGGGYRSD… |
| A0A5C1QE93 | 9-109 | None |
| A0A1A7C6V6 | 33-183 | None |
| A0A3A5MHL5 | 452-563 | None |
| A4QHJ3 | 2-110 | None |
| Z9JGJ2 | 12-134 | None |
| A0A6I6AH92 | 6-100 | None |
| A0A1Q8YE38 | 141-309 | None |
| A0A1F4JXV8 | 172-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.