DPCstruct | MC44804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 126 ± 31 aa |
| Standard deviation of domain lengths | 31.29 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 69.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1CSL0 | 30-155 | SSSSSDKVYSFVAIPGTNQKKRPRRRYDEIERLYHCNFPGCTKSYGTLNHLNAHVSMQQHGPKRQPSEFKEMRKEWRRQKKERESAK… |
| A0A1K0GVI7 | 470-544 | GDGSGGSEQDSLHGSSEGFRRIRRRRKSEEVERKYRCDYDGCDKAYGTLNHLNTHRATNDHGPRLNADIDELTRS |
| A0A0G2FBC8 | 14-155 | None |
| G4TIN3 | 963-1089 | None |
| M9MFP3 | 178-315 | None |
| A0A066V854 | 1-68 | None |
| A0A1D1YJM5 | 350-538 | None |
| N4UK71 | 33-116 | None |
| I4YI14 | 1-142 | None |
| A0A0N0NNA8 | 106-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.