DPCstruct | MC44801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 325 ± 58 aa |
| Standard deviation of domain lengths | 57.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.29 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF04112- CL0662- PF01214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1CHD1 | 1-252 | MDSRMDTGMAIKEEPAFDITKQLTADQVVDIMDNLVIREIAWLSGHSISQTVFTCVYFHHLTELYESKTDDTVYSSLRIYILATMKC… |
| A0A0C3NP43 | 2-235 | IDRAFSCEMAWHAGCTLSQTVFSFLYVHALPNLDPDTIAQSHHGESDRARPIELVSVVLRASVLGLLKCCDLAWRELIKGNVYDSED… |
| A0A812M117 | 2-211 | None |
| A0A6V7U7M1 | 6-335 | None |
| A0A0F7SL68 | 1-338 | None |
| A0A1R0H185 | 6-357 | None |
| A0A5K4EFD3 | 1-365 | None |
| A0A7S3UZB2 | 1-257 | None |
| S2J038 | 17-334 | None |
| A0A0P1ACA5 | 266-721 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.