DPCstruct | MC4480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0L7H6 | 81-181 | HTRLGELLPAHQLPLMSSLKISGAFSLAEAHSWVGSCLPEVPVRLQGDEGHYMFRNTFLGTLLACSYKKGEANFMSESITSLAIVKE… |
| A0A1I8B347 | 71-187 | FVQIDQSFAQQKPPECFVSFRLQSRIDQFRLWICENFAFIDEEKLQNEPSIVAESKGDDGGKKLQLYFFCTRNQEILYINWDLTSGE… |
| A0A812U7W1 | 819-950 | None |
| A0A6G0YYC0 | 825-927 | None |
| A0A0S7JAP3 | 2-113 | None |
| A0A183P6P6 | 391-521 | None |
| A0A6V7U7B0 | 91-232 | None |
| U4UA74 | 1034-1163 | None |
| A0A1Y1NIH9 | 108-207 | None |
| A0A1Y1NJL7 | 9-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.