DPCstruct | MC448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 20.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S5AXT0 | 1-134 | MQREPDDHDATWRSIVENYGDPVLEPDEELAPQVEPAAPAWNPDDDSDRIPAELDDTFVPPPAPPIPRPSSDRLLAWLGLFGAPAIL… |
| A0A1H8IPF7 | 1-158 | MADREDEGAAPLDEDAAWAALIAGFDEEPAPGAKSAWPDAENVAEEPPVPKAPPPARSIVVHPVIQGPRDYELEDDDEDAHFVPPEP… |
| A0A0A0J6P6 | 2-127 | None |
| A0A4T0UQG8 | 251-415 | None |
| A0A354XP04 | 9-143 | None |
| A0A6I5X4S2 | 2-160 | None |
| A0A4Y3R698 | 20-220 | None |
| A0A0S9QA94 | 5-172 | None |
| A0A1J7C9D9 | 21-181 | None |
| A0A6V8LEL7 | 3-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.