DPCstruct | MC44799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 143 ± 32 aa |
| Standard deviation of domain lengths | 31.91 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1CDR5 | 563-711 | PSQYVNIRHVNQDTFAVIDVTDNKNTVMEEIEVSRAGFEIYEGAIFIHQGRTYLVEECHIDKRYAKVHLVRVNWTTTQRDYTDVDAI… |
| A0A5S9MAU5 | 1-148 | MVIVDQSDVANVRIIGEMDRFSAMTLLHDEAIYLHEGVQYQVEKLDYEHLKAYVKQVDVEYYTDANLAVQLKVLEIDQTTEKEAVSV… |
| A0A7I4DT40 | 916-1103 | None |
| A0A3A0AYS8 | 15-156 | None |
| A0A0K2RNM5 | 39-178 | None |
| A0A7C6LAN5 | 1-125 | None |
| A0A443N3Y9 | 1-118 | None |
| A0A4Q3JWD5 | 267-402 | None |
| A0A099NXF5 | 693-853 | None |
| A0A6G3VJK3 | 43-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.