DPCstruct | MC4479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 107 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 77.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2K823 | 189-301 | HDILDMMPEGVKQNKAKTILQHLSEAWRCWKANIPWKVPGLPAPVENMILRYVKHKADWWTQVAHYNRERIRRGATVDKTVCRKNLG… |
| C6H9U1 | 582-689 | ADLMDMMPEGIKQNKVNTVLQHLSEAWRCWKSNIPWKVPGLPAPIENIILRYVKSKADWWISVAHYNRERIRRGATVDKTVAKKNLG… |
| A0A1D6LLL6 | 279-387 | None |
| A0A835S4Q7 | 42-141 | None |
| A0A5P1FIE4 | 6-106 | None |
| A0A086M4B6 | 323-435 | None |
| A0A183S6F1 | 1-104 | None |
| A0A251RZF6 | 59-149 | None |
| A0A2H1CAH6 | 669-787 | None |
| A0A7J6VC43 | 159-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.