DPCstruct | MC44786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 250 ± 53 aa |
| Standard deviation of domain lengths | 53.22 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811A289 | 23-254 | LTPPAHAIKAANDNVVIVGGGPIETLPHNFQAQVAGRVRLVDAIACNEWIDVWEASEWIGAPVEGLEAWSVRLIETMKSRFTSVPGE… |
| A0A4Q3BBQ4 | 1-130 | MSTIAIGNERGLERFDCVSGRWSEVESTNSAGAYRFDHSGMTYAFRGADGVATSGPHEIVKLKAARHSGVHLHYYDHNRMAFLSALG… |
| A0A060HMA2 | 14-263 | None |
| M6CTH6 | 369-688 | None |
| A0A447JCF6 | 53-395 | None |
| A0A1C5K9H7 | 481-708 | None |
| A0A7W1A717 | 14-241 | None |
| A0A7X4KEK2 | 565-830 | None |
| A0A358IR43 | 302-520 | None |
| A0A7L5AHR2 | 404-630 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.