DPCstruct | MC44785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 172 ± 23 aa |
| Standard deviation of domain lengths | 23.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6H3P7 | 2-170 | AINQATRNNTAVVLAVCYGSEISKFSSKTAPCPFNYLIAAPDEVQAGYLRDVIPGFYKSVVQSGDLQAGLALLAAPLKLFHCGEWFY… |
| A0A091AZX8 | 2-203 | LHVECHGNDDGLAFADGSFASWADLKEPLTSLNVVTGMNLLVIVSACDGSALTHALSPVDRAPLHGLIGPTRAVAPNELARAYLALY… |
| A0A5E7QBG9 | 18-191 | None |
| A0A4Y8ML39 | 164-333 | None |
| A0A259MCN0 | 66-197 | None |
| A0A7W0GMZ1 | 1-172 | None |
| A0A509MQ89 | 3-149 | None |
| A0A7W0EPV4 | 3-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.