DPCstruct | MC4478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 228 ± 18 aa |
| Standard deviation of domain lengths | 18.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04121 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W4V766 | 2-235 | MRTYLACNKMDCVRQTFRMVPGDIVPQIVGIYGSVDNIPPREECCLKEYLCYKVYLTGVDSFVEWNRLQLNRPKKPQAGMSVSAQDN… |
| A0A1I8AZM3 | 2-244 | LRAWKWLTFCGTELIWDAIVEANYLLRKFFLHNRMDEAMELMRMAPESLGADYFQEKFPDVEVPIRLLDAKYEFECYQFYFEAINRY… |
| A0A0L0C1X8 | 607-872 | None |
| A0A7S0G058 | 210-417 | None |
| A0A7R8WN62 | 7-214 | None |
| A0A183BHN2 | 542-773 | None |
| A0A0B2V804 | 102-305 | None |
| A0A2S2PJQ5 | 20-243 | None |
| A0A1D2MFK1 | 631-873 | None |
| H3DPY3 | 199-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.