DPCstruct | MC44778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 196 ± 23 aa |
| Standard deviation of domain lengths | 22.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0WS94 | 227-376 | LVRLVGLIWGGSPDTNWPPTGRPDMPPYVSEYLRRKQTKQKDPYIALRSSLLEQTTRRSCHACRKPVHEKETSGGFARCANCRAVRY… |
| A0A2H3BQ97 | 3-201 | HASKIVELLSKALRIEQQTRNRELKNAIREQNFQDIAAVLMRMFSLPEDAQKYHPLILTTLKRQRENVPVSLERSPFASAYDAVRTI… |
| J0WUX4 | 172-419 | None |
| J0CXK2 | 4-220 | None |
| J0D788 | 143-311 | None |
| J0D8F2 | 386-563 | None |
| J0LEY5 | 213-407 | None |
| J0WS17 | 103-296 | None |
| J0WT04 | 175-362 | None |
| J0CWC5 | 207-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.