DPCstruct | MC44773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15653 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4L2X8 | 2-102 | KRKHGNALHNKKLHHLYEILDSEEDNDVFKYGICGHPIGKDGYSKRIREQLNLYNAVANCVRFFARVLITGIPGRAKAKQVEKEHIN… |
| A0A255TNR9 | 7-101 | PEEGYLYQLEVLQDGYYRNVRTNSMVYMKQGDVWKYGETTQGKRRYSRTSYEATHFKMQPLFYGTKTEILIQEKIMLYWYFFEHGQL… |
| D9SWJ2 | 35-125 | None |
| A0A2G3M7M2 | 2-84 | None |
| A0A8B0KMJ1 | 1002-1102 | None |
| A0A432Z409 | 349-452 | None |
| A0A7D7ZVJ6 | 305-401 | None |
| A0A1V3FII5 | 19-110 | None |
| Q1RGN5 | 434-533 | None |
| A0A291QWB0 | 652-751 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.