DPCstruct | MC44771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4KZK4 | 10-140 | APFVISSIADEDEVGKKVETDLLIQEFLNQHLKLSTYGEGLTGIAFVYIVTPPIDVIHQDEIIYRAKKKELYIEMRLSYEKVVAASD… |
| A0A383R5N8 | 1-122 | MDFSIISDTAGARVGELASELRKALESNINSKYGHVDVSIGIGFRCLPESYGRRSFIRYTKKDNYLTIDLAVKVEEYEKMYKVEQRY… |
| A0A1H6UEG5 | 127-272 | None |
| A0A7H8NQ04 | 1-165 | None |
| A0A3D9IH79 | 123-290 | None |
| A0A3A5EG53 | 3-139 | None |
| A0A2W4HYF9 | 2-188 | None |
| A0A3A8RT82 | 1-126 | None |
| A0A7T9E5C4 | 1-154 | None |
| A0A0H3DAW3 | 13-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.