DPCstruct | MC4477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A858QC80 | 2-89 | DMTAAVQSAKTRADHEALAAHYEQAAKDAAIKIDEHKKLLEQYKTRGYLYGKQALNFQSHCEAIIRSYQQIGNANSEMAKMHRQLAES |
| A0A2T5X3G2 | 1-117 | MLGLLASCAQMGPMEAQSDNIRMAATNARTYADHDKLVKQYQRTAKEMLVKAEEQKKLLQHYEEKSYLYGRQAQDKQSHTLALLHKY… |
| A0A1K1LYH7 | 45-159 | None |
| A0A1G5J0Z1 | 3-119 | None |
| A0A1G5BZ10 | 33-143 | None |
| A0A177MMX9 | 14-104 | None |
| A0A2P7NVF8 | 12-129 | None |
| A0A5C7VMB6 | 1-119 | None |
| A0A4R7AGR0 | 12-117 | None |
| A0A4Q5L4Q4 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.