DPCstruct | MC44765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 319 ± 53 aa |
| Standard deviation of domain lengths | 52.74 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF20169- PF01558 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0PPQ7 | 3-322 | ELALGQGSVISSCLFGALAGSGALPFPREAFEDAIRAGGKGVEPSLRAFSVGFDTAQNGIAEPEKDEFKLKPDMKGTGKQMQKWEVL… |
| A0A661EUY3 | 100-460 | AAKDCSIIANTYRYLGTLEKMPAEGGIFSSEEIRNAAETLSDNTWLFHAQNMVTEAGLSYLSSNAILMGAVIASPAFGLPAEPFHQA… |
| S9QUN2 | 73-381 | None |
| A0A7S4NIX1 | 4-268 | None |
| A0A661EL10 | 2-304 | None |
| A0A2N6T1F6 | 107-439 | None |
| A0A3D3DLI0 | 2-304 | None |
| A0A810KJI3 | 258-569 | None |
| A0A1Q3S008 | 6-326 | None |
| A0A5A7MNP5 | 1-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.