DPCstruct | MC44762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 243 ± 24 aa |
| Standard deviation of domain lengths | 23.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A528AUM4 | 3-240 | WVEKAIGIRKEIKSEHGDWPKIVELFERRNLFTHTNGIVNDRYLKKSVKLKVSGSSALVKGQELFAGSKYLTSALEIICEFGIKIIQ… |
| A0A426W363 | 37-280 | RNSHSEQFKWMEKKFNIPLTKNLTIWSDFIEITERRNLFVHNNGIVSRQYIKVCEDNGVKISEIKVGDTLKVKPKYLANAYLVFYEI… |
| A0A0N0SC79 | 20-249 | None |
| A0A165QUT7 | 50-315 | None |
| A0A0M3T4U3 | 7-225 | None |
| A0A7Z0EHR0 | 270-545 | None |
| A0A1H0JYZ5 | 2-247 | None |
| A0A542Y4I1 | 118-337 | None |
| A0A1R1DV36 | 1-245 | None |
| S9RU37 | 103-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.