DPCstruct | MC4476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 74.64 |
| Pfam Score | 94.12 |
| Assigned Pfam label(s) | CL0123- CL0062- PF03345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7FNW2 | 1-59 | MSPSVAKKTRKSLTLKVKLDIIHRHKRGQKTNSIACHHGLTPSTVSTIFKSADFIKKAG |
| A0A5B7H8X8 | 33-100 | MPPKCPATRLAMSPSIAKKTRKSLTHEVKLDIIDGHVRGEKTNSIARHHGLTPSTVSIFKSADSIKKA |
| A0A5B7IP28 | 1-58 | None |
| A0A5B7J6Y0 | 58-116 | None |
| A0A5B7DLK5 | 370-438 | None |
| A0A5B7DCG5 | 1-79 | None |
| A0A5B7F7F3 | 25-90 | None |
| A0A5B7FGW7 | 108-177 | None |
| A0A5B7F7Z3 | 1-65 | None |
| A0A5B7F1P7 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.