DPCstruct | MC44757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 109 ± 18 aa |
| Standard deviation of domain lengths | 18.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D8UJZ0 | 433-566 | LGDSWLGEWVNLGAGTTNSNLLNTYAEVPARATPEGRDERTGEQYLGCVLGDHVKTAICTRIMTGAIVHTGAMLAASAPVSGCVPAF… |
| A0A3D2IKS3 | 25-112 | FFGTVMGDHSKTSINSMLSTGTTCGVSSNIFTSAFPPKYIPSFTWLDGEKNPEFRFDKALEVMKAMMARRNVELSEEYEHMMRYIFEQ |
| A0A7Y3K6Y3 | 32-140 | None |
| A3MWU2 | 214-325 | None |
| A0A3M1YYF6 | 96-194 | None |
| A0A6S4QRF8 | 372-525 | None |
| A0A836VYP0 | 161-270 | None |
| A0A832FB58 | 235-343 | None |
| A0A521TNI0 | 330-452 | None |
| A0A7X8KD90 | 203-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.