DPCstruct | MC44754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350PAU0 | 1-77 | MIRFSQYITEAEEGLKKKAEKSGMPLGVLRKVYNRGVAAWKTGHRPGTTPQQWGFARVNSFVTKSSGTWGKADKDLA |
| A0A2E0WJB5 | 60-140 | KTKTSSYTQKFRKMYPGVKSLPEIAKATGVPLKTLKTVYNRGLAAWRTGHRPGASPQAWGYARVHSFVTKGKTYYTADKDL |
| A0A424LPW3 | 448-530 | None |
| A0A2D7BZT6 | 1-80 | None |
| A0A2D4ZE70 | 555-629 | None |
| A0A1Z9LSV1 | 304-377 | None |
| A0A2E0S3A4 | 486-565 | None |
| A0A6C0M0I6 | 18-100 | None |
| A0A2E8R886 | 94-164 | None |
| A0A1Z9ULW0 | 473-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.