DPCstruct | MC44747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11897 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3D297 | 3-83 | ETHFKIEVQPVIPKNLVGLNELANNLLYTWDRRVRRLFYQLDVKLWEDCGHNPKVFLRRIAQEKLDTAAKDNVFLEEYNRV |
| A0A7G1H3Y3 | 11-88 | IPERIADLGELAYNLWWSWHPEARMLFKMLDRQIWKESGHNPVRMLKELPHEVLETAVRNEEYLRHYDSVISRFHKEM |
| A0A524Q5V5 | 1-82 | None |
| X1BHW9 | 1-101 | None |
| A0A7C4NVN6 | 1-81 | None |
| A0A7V2G6J8 | 269-351 | None |
| A0A4Q2WHI1 | 1-82 | None |
| A0A0R2RPX6 | 20-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.